PDB entry 2ivy

View 2ivy on RCSB PDB site
Description: Crystal structure of hypothetical protein sso1404 from Sulfolobus solfataricus P2
Class: unknown function
Keywords: structural genomics, unknown function, cas, rnai, crispr
Deposited on 2006-06-22, released 2006-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein sso1404
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IVY
    • Uniprot Q97YC2 (1-End)
    Domains in SCOPe 2.08: d2ivya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ivyA (A:)
gamlylifyditddnlrnrvaeflkkkgldriqysvfmgdlnssrlkdveaglkiignrk
klqederffilivpitenqfrerivigysgsereeksnvvw

    Sequence, based on observed residues (ATOM records): (download) 
    >2ivyA (A:)
amlylifyditddnlrnrvaeflkkkgldriqysvfmgdlnssrlkdveaglkiignrkk
lqederffilivpitenqfrerivigys