Lineage for d2i8ea1 (2i8e A:2-89)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956212Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. 2956213Family d.58.58.1: CRISPR associated protein Cas2-like [143431] (5 proteins)
    Pfam PF09827
  6. 2956227Protein Hypothetical protein SSO1404 [160348] (1 species)
    predicted DNA repair associated protein
  7. 2956228Species Sulfolobus solfataricus [TaxId:2287] [160349] (1 PDB entry)
    Uniprot Q97YC2 2-89
  8. 2956229Domain d2i8ea1: 2i8e A:2-89 [147563]
    complexed with iod

Details for d2i8ea1

PDB Entry: 2i8e (more details), 1.59 Å

PDB Description: structure of sso1404, a predicted dna repair-associated protein from sulfolobus solfataricus p2
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2i8ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i8ea1 d.58.58.1 (A:2-89) Hypothetical protein SSO1404 {Sulfolobus solfataricus [TaxId: 2287]}
amlylifyditddnlrnrvaeflkkkgldriqysvfmgdlnssrlkdveaglkiignrkk
lqederffilivpitenqfrerivigys

SCOPe Domain Coordinates for d2i8ea1:

Click to download the PDB-style file with coordinates for d2i8ea1.
(The format of our PDB-style files is described here.)

Timeline for d2i8ea1: