![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) ![]() contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily |
![]() | Family d.58.58.1: CRISPR associated protein Cas2-like [143431] (5 proteins) Pfam PF09827 |
![]() | Protein Hypothetical protein SSO1404 [160348] (1 species) predicted DNA repair associated protein |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [160349] (1 PDB entry) Uniprot Q97YC2 2-89 |
![]() | Domain d2i8ea1: 2i8e A:2-89 [147563] complexed with iod |
PDB Entry: 2i8e (more details), 1.59 Å
SCOPe Domain Sequences for d2i8ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i8ea1 d.58.58.1 (A:2-89) Hypothetical protein SSO1404 {Sulfolobus solfataricus [TaxId: 2287]} amlylifyditddnlrnrvaeflkkkgldriqysvfmgdlnssrlkdveaglkiignrkk lqederffilivpitenqfrerivigys
Timeline for d2i8ea1: