![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Transcriptional regulator TM1030 [140209] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [140210] (8 PDB entries) Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75 |
![]() | Domain d2ieka1: 2iek A:2-75 [147647] Other proteins in same PDB: d2ieka2 automated match to d1z77a1 complexed with p6g |
PDB Entry: 2iek (more details), 1.83 Å
SCOPe Domain Sequences for d2ieka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ieka1 a.4.1.9 (A:2-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} lskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtek lqkefenflmknrn
Timeline for d2ieka1: