Lineage for d2ieka1 (2iek A:2-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981851Protein Transcriptional regulator TM1030 [140209] (1 species)
  7. 1981852Species Thermotoga maritima [TaxId:2336] [140210] (8 PDB entries)
    Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75
  8. 1981854Domain d2ieka1: 2iek A:2-75 [147647]
    Other proteins in same PDB: d2ieka2
    automated match to d1z77a1
    complexed with p6g

Details for d2ieka1

PDB Entry: 2iek (more details), 1.83 Å

PDB Description: New crystal form of transcriptional regulator tm1030 from Thermotoga maritima
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d2ieka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ieka1 a.4.1.9 (A:2-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
lskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtek
lqkefenflmknrn

SCOPe Domain Coordinates for d2ieka1:

Click to download the PDB-style file with coordinates for d2ieka1.
(The format of our PDB-style files is described here.)

Timeline for d2ieka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ieka2