Lineage for d2ieka1 (2iek A:2-75)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Transcriptional regulator TM1030 [140209] (1 species) Species Thermotoga maritima [TaxId:2336] [140210] (8 PDB entries)
Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75
Domain d2ieka1: 2iek A:2-75 [147647]
Other proteins in same PDB: d2ieka2
automated match to d1z77a1
complexed with p6g
Details for d2ieka1
PDB Entry: 2iek (more details), 1.83 Å
PDB Description: new crystal form of transcriptional regulator tm1030 from thermotoga maritima
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILYSCOPe Domain Sequences for d2ieka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ieka1 a.4.1.9 (A:2-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
lskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtek
lqkefenflmknrn
SCOPe Domain Coordinates for d2ieka1:
Click to download the PDB-style file with coordinates for d2ieka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ieka1:
- d2ieka1 first appeared in SCOP 1.75
- d2ieka1 appears in SCOPe 2.07
View in 3D
