SCOPe 2.02: Domain d2hr6a_: 2hr6 A:

Lineage for d2hr6a_ (2hr6 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
   Uniprot P06968

8. Domain d2hr6a_: 2hr6 A: [147375]
   automated match to d1rn8a_
   complexed with dud, edo, mn

Details for d2hr6a_

PDB Entry: 2hr6, 1.84 Å

PDB Description: Crystal structure of dUTPase in complex with substrate analogue dUDP and manganese

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2hr6a_:

Sequence; same for both SEQRES and ATOM records:

>d2hr6a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfd

Timeline for d2hr6a_:

• d2hr6a_ first appeared in SCOP 1.75, called d2hr6a1
  
• d2hr6a_ appears in SCOPe 2.01
  
• d2hr6a_ appears in SCOPe 2.03
  
• d2hr6a_ appears in the current release, SCOPe 2.08, called d2hr6a2