Lineage for d1rn8a_ (1rn8 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139618Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1139747Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1139748Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1139800Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 1139804Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
    Uniprot P06968
  8. 1139811Domain d1rn8a_: 1rn8 A: [105020]
    complexed with act, dup, mg, trs

Details for d1rn8a_

PDB Entry: 1rn8 (more details), 1.93 Å

PDB Description: crystal structure of dutpase complexed with substrate analogue imido- dutp
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1rn8a_:

Sequence, based on SEQRES records: (download)

>d1rn8a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdatdrgeggfghsgrq

Sequence, based on observed residues (ATOM records): (download)

>d1rn8a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdfrq

SCOPe Domain Coordinates for d1rn8a_:

Click to download the PDB-style file with coordinates for d1rn8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rn8a_: