Lineage for d1rn8a1 (1rn8 A:2-152)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818072Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2818142Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2818146Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
    Uniprot P06968
  8. 2818150Domain d1rn8a1: 1rn8 A:2-152 [105020]
    Other proteins in same PDB: d1rn8a2
    complexed with act, dup, mg, trs

Details for d1rn8a1

PDB Entry: 1rn8 (more details), 1.93 Å

PDB Description: crystal structure of dutpase complexed with substrate analogue imido- dutp
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1rn8a1:

Sequence, based on SEQRES records: (download)

>d1rn8a1 b.85.4.1 (A:2-152) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad
pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi
fvpvvqaefnlvedfdatdrgeggfghsgrq

Sequence, based on observed residues (ATOM records): (download)

>d1rn8a1 b.85.4.1 (A:2-152) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad
pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi
fvpvvqaefnlvedfdfrq

SCOPe Domain Coordinates for d1rn8a1:

Click to download the PDB-style file with coordinates for d1rn8a1.
(The format of our PDB-style files is described here.)

Timeline for d1rn8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rn8a2