Class b: All beta proteins [48724] (144 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (1 family) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (2 proteins) |
Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (5 species) |
Species Escherichia coli [TaxId:562] [51286] (8 PDB entries) |
Domain d1rn8a_: 1rn8 A: [105020] |
PDB Entry: 1rn8 (more details), 1.93 Å
SCOP Domain Sequences for d1rn8a_:
Sequence, based on SEQRES records: (download)
>d1rn8a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli} mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm ifvpvvqaefnlvedfdatdrgeggfghsgrq
>d1rn8a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli} mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm ifvpvvqaefnlvedfdfrq
Timeline for d1rn8a_: