SCOP 1.69: Domain d1rn8a_: 1rn8 A:

Lineage for d1rn8a_ (1rn8 A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (2 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (5 species)

7. Species Escherichia coli [TaxId:562] [51286] (8 PDB entries)

8. Domain d1rn8a_: 1rn8 A: [105020]

Details for d1rn8a_

PDB Entry: 1rn8, 1.93 Å

PDB Description: crystal structure of dutpase complexed with substrate analogue imido- dutp

SCOP Domain Sequences for d1rn8a_:

Sequence, based on SEQRES records:

>d1rn8a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdatdrgeggfghsgrq

Sequence, based on observed residues (ATOM records):

>d1rn8a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdfrq

Timeline for d1rn8a_:

• d1rn8a_ is new in SCOP 1.69
  
• d1rn8a_ appears in SCOP 1.71
  
• d1rn8a_ appears in the current release, SCOPe 2.08, called d1rn8a1