SCOP 1.75: Domain d2hr6a1: 2hr6 A:1-137

Lineage for d2hr6a1 (2hr6 A:1-137)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (4 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)

7. Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
   Uniprot P06968

8. Domain d2hr6a1: 2hr6 A:1-137 [147375]
   automatically matched to d1rn8a_
   complexed with dud, edo, mn

Details for d2hr6a1

PDB Entry: 2hr6, 1.84 Å

PDB Description: Crystal structure of dUTPase in complex with substrate analogue dUDP and manganese

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOP Domain Sequences for d2hr6a1:

Sequence; same for both SEQRES and ATOM records:

>d2hr6a1 b.85.4.1 (A:1-137) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfd

Timeline for d2hr6a1:

• d2hr6a1 is new in SCOP 1.75
  
• d2hr6a1 is called d2hr6a_ in SCOPe 2.01
  
• d2hr6a1 appears in the current release, SCOPe 2.08, called d2hr6a2