Lineage for d2f86n_ (2f86 N:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2544255Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2544256Protein automated matches [190205] (33 species)
    not a true protein
  7. 2544338Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187281] (2 PDB entries)
  8. 2544345Domain d2f86n_: 2f86 N: [147004]
    Other proteins in same PDB: d2f86b1
    automated match to d1hkxd_

Details for d2f86n_

PDB Entry: 2f86 (more details), 2.64 Å

PDB Description: the association domain of c. elegans camkii
PDB Compounds: (N:) Hypothetical protein K11E8.1d

SCOPe Domain Sequences for d2f86n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f86n_ d.17.4.0 (N:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndsekaqkqdivrvtqtlldaisckdfetytrlcdtsmtcfepealgnliegiefhrfyf
dgnrknqvhttmlnpnvhiigedaacvayvkltqfldrngeahtrqsqesrvwskkqgrw
vcvhvhrst

SCOPe Domain Coordinates for d2f86n_:

Click to download the PDB-style file with coordinates for d2f86n_.
(The format of our PDB-style files is described here.)

Timeline for d2f86n_: