SCOPe 2.07: Domain d2f86f_: 2f86 F:

Lineage for d2f86f_ (2f86 F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (33 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187281] (2 PDB entries)

8. Domain d2f86f_: 2f86 F: [147000]
   Other proteins in same PDB: d2f86b1
   automated match to d1hkxd_

Details for d2f86f_

PDB Entry: 2f86, 2.64 Å

PDB Description: the association domain of c. elegans camkii

PDB Compounds: (F:) Hypothetical protein K11E8.1d

SCOPe Domain Sequences for d2f86f_:

Sequence; same for both SEQRES and ATOM records:

>d2f86f_ d.17.4.0 (F:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndsekaqkqdivrvtqtlldaisckdfetytrlcdtsmtcfepealgnliegiefhrfyf
dgnrknqvhttmlnpnvhiigedaacvayvkltqfldrngeahtrqsqesrvwskkqgrw
vcvhvhrst

Timeline for d2f86f_:

• d2f86f_ first appeared in SCOP 1.75, called d2f86f1
  
• d2f86f_ appears in SCOPe 2.06
  
• d2f86f_ appears in the current release, SCOPe 2.08