![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
![]() | Protein automated matches [190205] (33 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187281] (2 PDB entries) |
![]() | Domain d2f86l_: 2f86 L: [147003] Other proteins in same PDB: d2f86b1 automated match to d1hkxd_ |
PDB Entry: 2f86 (more details), 2.64 Å
SCOPe Domain Sequences for d2f86l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f86l_ d.17.4.0 (L:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ndsekaqkqdivrvtqtlldaisckdfetytrlcdtsmtcfepealgnliegiefhrfyf dgnrknqvhttmlnpnvhiigedaacvayvkltqfldrngeahtrqsqesrvwskkqgrw vcvhvhrst
Timeline for d2f86l_: