SCOPe 2.08: Domain d2ec5a1: 2ec5 A:575-874

Lineage for d2ec5a1 (2ec5 A:575-874)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.296: PMT central region-like [158841] (1 superfamily)
   multihelical; comprises two four-helical bundles of different topologies and an irregular helical array packed against a small beta-sheet

4. Superfamily a.296.1: PMT central region-like [158842] (1 family)

5. Family a.296.1.1: PMT central region-like [158843] (1 protein)

6. Protein Dermonecrotic toxin, ToxA [158844] (1 species)
   Synonym: Mitogenic toxin PMT

7. Species Pasteurella multocida [TaxId:747] [158845] (3 PDB entries)
   Uniprot P17452 575-874

8. Domain d2ec5a1: 2ec5 A:575-874 [146778]
   Other proteins in same PDB: d2ec5a2, d2ec5a3, d2ec5b2, d2ec5b3

Details for d2ec5a1

PDB Entry: 2ec5, 2.6 Å

PDB Description: crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin

PDB Compounds: (A:) Dermonecrotic toxin

SCOPe Domain Sequences for d2ec5a1:

Sequence; same for both SEQRES and ATOM records:

>d2ec5a1 a.296.1.1 (A:575-874) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
lggspyspfriglegvwtpevlkarasvigkpigesykrilaklqrihnsnilderqglm
helmelidlyeesqpsserlnafrelrtqlekalylpemealkkqilqipnkgsgaarfl
lrtamnemagktsestadlirfalqdtvisapfrgyagaipeaidfpvkyviedisvfdk
iqtnywelpayeswnegsnsallpgllresqskgmlskcriienslyighsyeemfysis
pysnqvggpyelypftffsmlqevqgdlgfeqafatrnffntlvsdrlslmentmlltes

Timeline for d2ec5a1:

• d2ec5a1 first appeared in SCOP 1.75
  
• d2ec5a1 appears in SCOPe 2.07