SCOPe 2.08: Domain d2ec5b2: 2ec5 B:875-1093

Lineage for d2ec5b2 (2ec5 B:875-1093)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.150: EreA/ChaN-like [159500] (1 superfamily)
   Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423;

4. Superfamily c.150.1: EreA/ChaN-like [159501] (3 families)
   there are four conserved residues in the putative active site: two His and two Glu

5. Family c.150.1.2: PMT domain-like [159505] (1 protein)
   This is the second from the PMT C-terminus; it retains the superfamily fold and the active site mainchain conformation but lacks the conserved in the other two families His and Glu residues

6. Protein Dermonecrotic toxin, ToxA [159506] (1 species)
   Synonym: Mitogenic toxin PMT

7. Species Pasteurella multocida [TaxId:747] [159507] (3 PDB entries)
   Uniprot P17452 875-1093

8. Domain d2ec5b2: 2ec5 B:875-1093 [146782]
   Other proteins in same PDB: d2ec5a1, d2ec5a3, d2ec5b1, d2ec5b3
   automated match to d2ec5a2

Details for d2ec5b2

PDB Entry: 2ec5, 2.6 Å

PDB Description: crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin

PDB Compounds: (B:) Dermonecrotic toxin

SCOPe Domain Sequences for d2ec5b2:

Sequence; same for both SEQRES and ATOM records:

>d2ec5b2 c.150.1.2 (B:875-1093) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
fdytpwdaiygdinydeqfaamsineriekcmntyrgvafqnssksidfflnnlttfidn
glteiaisdlpydivqqeisqflqgsnewktldamlfnldkgdingafrkllqsakdnni
kfraighsdnsvppfnnpykslyykgniiaeaiekldregqkfvvfadssllnstpgtgr
pmpglvqylkipatvvdsdgawqflpdvassrvpievte

Timeline for d2ec5b2:

• d2ec5b2 first appeared in SCOP 1.75
  
• d2ec5b2 appears in SCOPe 2.07