![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.150: EreA/ChaN-like [159500] (1 superfamily) Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423; |
![]() | Superfamily c.150.1: EreA/ChaN-like [159501] (3 families) ![]() there are four conserved residues in the putative active site: two His and two Glu |
![]() | Family c.150.1.2: PMT domain-like [159505] (1 protein) This is the second from the PMT C-terminus; it retains the superfamily fold and the active site mainchain conformation but lacks the conserved in the other two families His and Glu residues |
![]() | Protein Dermonecrotic toxin, ToxA [159506] (1 species) Synonym: Mitogenic toxin PMT |
![]() | Species Pasteurella multocida [TaxId:747] [159507] (3 PDB entries) Uniprot P17452 875-1093 |
![]() | Domain d2ec5b2: 2ec5 B:875-1093 [146782] Other proteins in same PDB: d2ec5a1, d2ec5a3, d2ec5b1, d2ec5b3 automated match to d2ec5a2 |
PDB Entry: 2ec5 (more details), 2.6 Å
SCOPe Domain Sequences for d2ec5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ec5b2 c.150.1.2 (B:875-1093) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]} fdytpwdaiygdinydeqfaamsineriekcmntyrgvafqnssksidfflnnlttfidn glteiaisdlpydivqqeisqflqgsnewktldamlfnldkgdingafrkllqsakdnni kfraighsdnsvppfnnpykslyykgniiaeaiekldregqkfvvfadssllnstpgtgr pmpglvqylkipatvvdsdgawqflpdvassrvpievte
Timeline for d2ec5b2: