Lineage for d2ec5a1 (2ec5 A:575-874)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2352273Fold a.296: PMT central region-like [158841] (1 superfamily)
    multihelical; comprises two four-helical bundles of different topologies and an irregular helical array packed against a small beta-sheet
  4. 2352274Superfamily a.296.1: PMT central region-like [158842] (1 family) (S)
  5. 2352275Family a.296.1.1: PMT central region-like [158843] (1 protein)
  6. 2352276Protein Dermonecrotic toxin, ToxA [158844] (1 species)
    Synonym: Mitogenic toxin PMT
  7. 2352277Species Pasteurella multocida [TaxId:747] [158845] (3 PDB entries)
    Uniprot P17452 575-874
  8. 2352280Domain d2ec5a1: 2ec5 A:575-874 [146778]
    Other proteins in same PDB: d2ec5a2, d2ec5a3, d2ec5b2, d2ec5b3

Details for d2ec5a1

PDB Entry: 2ec5 (more details), 2.6 Å

PDB Description: crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin
PDB Compounds: (A:) Dermonecrotic toxin

SCOPe Domain Sequences for d2ec5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ec5a1 a.296.1.1 (A:575-874) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
lggspyspfriglegvwtpevlkarasvigkpigesykrilaklqrihnsnilderqglm
helmelidlyeesqpsserlnafrelrtqlekalylpemealkkqilqipnkgsgaarfl
lrtamnemagktsestadlirfalqdtvisapfrgyagaipeaidfpvkyviedisvfdk
iqtnywelpayeswnegsnsallpgllresqskgmlskcriienslyighsyeemfysis
pysnqvggpyelypftffsmlqevqgdlgfeqafatrnffntlvsdrlslmentmlltes

SCOPe Domain Coordinates for d2ec5a1:

Click to download the PDB-style file with coordinates for d2ec5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ec5a1: