Lineage for d2ec5a1 (2ec5 A:575-874)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781532Fold a.296: PMT central region-like [158841] (1 superfamily)
    multihelical; comprises two four-helical bundles of different topologies and an irregular helical array packed against a small beta-sheet
  4. 781533Superfamily a.296.1: PMT central region-like [158842] (1 family) (S)
  5. 781534Family a.296.1.1: PMT central region-like [158843] (1 protein)
  6. 781535Protein Dermonecrotic toxin, ToxA [158844] (1 species)
    Synonym: Mitogenic toxin PMT
  7. 781536Species Pasteurella multocida [TaxId:747] [158845] (3 PDB entries)
    Uniprot P17452 575-874
  8. 781539Domain d2ec5a1: 2ec5 A:575-874 [146778]
    Other proteins in same PDB: d2ec5a2, d2ec5a3, d2ec5b2, d2ec5b3
    mutant

Details for d2ec5a1

PDB Entry: 2ec5 (more details), 2.6 Å

PDB Description: Crystal structures reveal a thiol-protease like catalytic triad in the C-terminal region of Pasteurella multocida toxin
PDB Compounds: (A:) Dermonecrotic toxin

SCOP Domain Sequences for d2ec5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ec5a1 a.296.1.1 (A:575-874) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
lggspyspfriglegvwtpevlkarasvigkpigesykrilaklqrihnsnilderqglm
helmelidlyeesqpsserlnafrelrtqlekalylpemealkkqilqipnkgsgaarfl
lrtamnemagktsestadlirfalqdtvisapfrgyagaipeaidfpvkyviedisvfdk
iqtnywelpayeswnegsnsallpgllresqskgmlskcriienslyighsyeemfysis
pysnqvggpyelypftffsmlqevqgdlgfeqafatrnffntlvsdrlslmentmlltes

SCOP Domain Coordinates for d2ec5a1:

Click to download the PDB-style file with coordinates for d2ec5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ec5a1: