SCOPe 2.08: Domain d2e9xh1: 2e9x H:21-165

Lineage for d2e9xh1 (2e9x H:21-165)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
   5 helices, staggered bundle;

4. Superfamily a.278.1: GINS helical bundle-like [158573] (4 families)
   common to all subunits of the GINS complex

5. Family a.278.1.4: SLD5 N-terminal domain-like [158583] (2 proteins)
   N-terminal part of Pfam PF05916

6. Protein GINS complex subunit 4, SLD5 [158584] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158585] (3 PDB entries)
   Uniprot Q9BRT9 21-165

8. Domain d2e9xh1: 2e9x H:21-165 [146751]
   Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xb2, d2e9xc1, d2e9xc2, d2e9xc3, d2e9xd2, d2e9xe_, d2e9xf1, d2e9xf2, d2e9xg1, d2e9xg2, d2e9xh2
   automated match to d2e9xd1
   protein/DNA complex; complexed with so4

Details for d2e9xh1

PDB Entry: 2e9x, 2.3 Å

PDB Description: the crystal structure of human gins core complex

PDB Compounds: (H:) GINS complex subunit 4

SCOPe Domain Sequences for d2e9xh1:

Sequence, based on SEQRES records:

>d2e9xh1 a.278.1.4 (H:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlrrakredlkvsihqm
emeriryvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesy
lknvalkhmppnlqkvdlfravpkp

Sequence, based on observed residues (ATOM records):

>d2e9xh1 a.278.1.4 (H:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenedlkvsihqmemerir
yvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesylknval
khmppnlqkvdlfravpkp

Timeline for d2e9xh1:

• d2e9xh1 first appeared in SCOP 1.75
  
• d2e9xh1 appears in SCOPe 2.07