![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.278: GINS helical bundle-like [158572] (1 superfamily) 5 helices, staggered bundle; |
![]() | Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) ![]() common to all subunits of the GINS complex |
![]() | Family a.278.1.4: SLD5 N-terminal domain-like [158583] (1 protein) N-terminal part of Pfam PF05916 |
![]() | Protein GINS complex subunit 4, SLD5 [158584] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158585] (3 PDB entries) Uniprot Q9BRT9 21-165 |
![]() | Domain d2e9xh1: 2e9x H:21-165 [146751] Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xb2, d2e9xc1, d2e9xc2, d2e9xd2, d2e9xe1, d2e9xf1, d2e9xf2, d2e9xg1, d2e9xg2, d2e9xh2 automatically matched to 2E9X D:21-165 complexed with so4 |
PDB Entry: 2e9x (more details), 2.3 Å
SCOP Domain Sequences for d2e9xh1:
Sequence, based on SEQRES records: (download)
>d2e9xh1 a.278.1.4 (H:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]} ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlrrakredlkvsihqm emeriryvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesy lknvalkhmppnlqkvdlfravpkp
>d2e9xh1 a.278.1.4 (H:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]} ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenedlkvsihqmemerir yvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesylknval khmppnlqkvdlfravpkp
Timeline for d2e9xh1: