Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (17 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88775] (14 PDB entries) Uniprot P19483 |
Domain d2jdib3: 2jdi B:95-379 [145688] Other proteins in same PDB: d2jdia1, d2jdia2, d2jdib1, d2jdib2, d2jdic1, d2jdic2, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdig1, d2jdih1, d2jdih2 automatically matched to d1bmfa3 complexed with anp, mg |
PDB Entry: 2jdi (more details), 1.9 Å
SCOP Domain Sequences for d2jdib3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jdib3 c.37.1.11 (B:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq
Timeline for d2jdib3: