Lineage for d2jdig1 (2jdi G:1-272)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 834980Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 835096Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (1 family) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 835097Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 835098Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 835099Species Cow (Bos taurus) [TaxId:9913] [52946] (14 PDB entries)
    Uniprot P05631
  8. 835100Domain d2jdig1: 2jdi G:1-272 [138272]
    Other proteins in same PDB: d2jdia1, d2jdia2, d2jdia3, d2jdib1, d2jdib2, d2jdib3, d2jdic1, d2jdic2, d2jdic3, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdih1, d2jdih2
    automatically matched to d1bmfg_
    complexed with anp, mg

Details for d2jdig1

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (G:) ATP synthase gamma chain

SCOP Domain Sequences for d2jdig1:

Sequence, based on SEQRES records: (download)

>d2jdig1 c.49.2.1 (G:1-272) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d2jdig1 c.49.2.1 (G:1-272) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgliigvssdrglcg
aihssvaiigvgdkirsiltfkevgrrpptfgdasvialelsiifnrfrsvisykteysl
aniiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisga
aal

SCOP Domain Coordinates for d2jdig1:

Click to download the PDB-style file with coordinates for d2jdig1.
(The format of our PDB-style files is described here.)

Timeline for d2jdig1: