Lineage for d2jdic1 (2jdi C:380-510)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771914Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 771915Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 771916Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 771917Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 771920Species Cow (Bos taurus) [TaxId:9913] [88893] (14 PDB entries)
    Uniprot P19483
  8. 771923Domain d2jdic1: 2jdi C:380-510 [145689]
    Other proteins in same PDB: d2jdia2, d2jdia3, d2jdib2, d2jdib3, d2jdic2, d2jdic3, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdig1, d2jdih1, d2jdih2
    automatically matched to d1bmfa1
    complexed with anp, mg

Details for d2jdic1

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (C:) ATP synthase subunit alpha heart isoform

SCOP Domain Sequences for d2jdic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdic1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d2jdic1:

Click to download the PDB-style file with coordinates for d2jdic1.
(The format of our PDB-style files is described here.)

Timeline for d2jdic1: