Lineage for d2jdic3 (2jdi C:95-379)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831197Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (17 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 831253Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 831256Species Cow (Bos taurus) [TaxId:9913] [88775] (14 PDB entries)
    Uniprot P19483
  8. 831259Domain d2jdic3: 2jdi C:95-379 [145691]
    Other proteins in same PDB: d2jdia1, d2jdia2, d2jdib1, d2jdib2, d2jdic1, d2jdic2, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdig1, d2jdih1, d2jdih2
    automatically matched to d1bmfa3
    complexed with anp, mg

Details for d2jdic3

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (C:) ATP synthase subunit alpha heart isoform

SCOP Domain Sequences for d2jdic3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdic3 c.37.1.11 (C:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d2jdic3:

Click to download the PDB-style file with coordinates for d2jdic3.
(The format of our PDB-style files is described here.)

Timeline for d2jdic3: