Lineage for d2jdif2 (2jdi F:10-81)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803679Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 803680Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 803681Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 803734Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 803774Species Rat (Rattus norvegicus) [TaxId:10116] [88679] (4 PDB entries)
  8. 803777Domain d2jdif2: 2jdi F:10-81 [138270]
    Other proteins in same PDB: d2jdia1, d2jdia2, d2jdia3, d2jdib1, d2jdib2, d2jdib3, d2jdic1, d2jdic2, d2jdic3, d2jdid1, d2jdid3, d2jdie1, d2jdie3, d2jdif1, d2jdif3, d2jdig1, d2jdih1, d2jdih2
    automatically matched to d1mabb2
    complexed with anp, mg

Details for d2jdif2

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (F:) ATP synthase subunit beta

SCOP Domain Sequences for d2jdif2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdif2 b.49.1.1 (F:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]}
tgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgtegl
vrgqkvldsgap

SCOP Domain Coordinates for d2jdif2:

Click to download the PDB-style file with coordinates for d2jdif2.
(The format of our PDB-style files is described here.)

Timeline for d2jdif2: