| Class g: Small proteins [56992] (98 folds) |
| Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
| Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
| Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species) duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6 |
| Species Human (Homo sapiens) [TaxId:9606] [161129] (6 PDB entries) Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108 |
| Domain d2i9bh3: 2i9b H:94-187 [145519] Other proteins in same PDB: d2i9ba1, d2i9ba2, d2i9bb1, d2i9bb2, d2i9bc1, d2i9bc2, d2i9bd1, d2i9bd2, d2i9be4, d2i9bf4 automated match to d2i9be3 complexed with bma, nag, so4 |
PDB Entry: 2i9b (more details), 2.8 Å
SCOPe Domain Sequences for d2i9bh3:
Sequence, based on SEQRES records: (download)
>d2i9bh3 g.7.1.3 (H:94-187) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
eciscgssdmscergrhqslqcrspeeqcldvvthwiqegeegrpkddrhlrgcgylpgc
pgsngfhnqdtfhflkccqttkcnegpilelenl
>d2i9bh3 g.7.1.3 (H:94-187) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
eciscgssdmschqslqcrspeeqcldvvthwiqkddrhlrgcgylpgcpgsngfhnqdt
fhflkccqttkcnegpilelenl
Timeline for d2i9bh3: