Lineage for d2i9bf3 (2i9b F:87-187)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2637112Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2637186Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 2637187Species Human (Homo sapiens) [TaxId:9606] [161129] (6 PDB entries)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 2637226Domain d2i9bf3: 2i9b F:87-187 [145513]
    Other proteins in same PDB: d2i9ba1, d2i9ba2, d2i9bb1, d2i9bb2, d2i9bc1, d2i9bc2, d2i9bd1, d2i9bd2, d2i9be4, d2i9bf4
    automated match to d2i9be3
    complexed with bma, nag, so4

Details for d2i9bf3

PDB Entry: 2i9b (more details), 2.8 Å

PDB Description: crystal structure of atf-urokinase receptor complex
PDB Compounds: (F:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d2i9bf3:

Sequence, based on SEQRES records: (download)

>d2i9bf3 g.7.1.3 (F:87-187) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
ysrsryleciscgssdmscergrhqslqcrspeeqcldvvthwiqegeegrpkddrhlrg
cgylpgcpgsngfhnqdtfhflkccqttkcnegpilelenl

Sequence, based on observed residues (ATOM records): (download)

>d2i9bf3 g.7.1.3 (F:87-187) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
ysrsryleciscgssdmschqslqcrspeeqcldvvthwiqrpkddrhlrgcgylpgcpg
sngfhnqdtfhflkccqttkcnegpilelenl

SCOPe Domain Coordinates for d2i9bf3:

Click to download the PDB-style file with coordinates for d2i9bf3.
(The format of our PDB-style files is described here.)

Timeline for d2i9bf3: