| Class g: Small proteins [56992] (98 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Plasminogen activator (urokinase-type) [57221] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries) |
| Domain d2i9bd1: 2i9b D:11-49 [137124] Other proteins in same PDB: d2i9ba2, d2i9bb2, d2i9bc2, d2i9bd2, d2i9be1, d2i9be2, d2i9be3, d2i9be4, d2i9bf1, d2i9bf2, d2i9bf3, d2i9bf4, d2i9bg1, d2i9bg2, d2i9bg3, d2i9bh1, d2i9bh2, d2i9bh3 automated match to d1urka1 complexed with bma, nag, so4 |
PDB Entry: 2i9b (more details), 2.8 Å
SCOPe Domain Sequences for d2i9bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9bd1 g.3.11.1 (D:11-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
cdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt
Timeline for d2i9bd1: