Lineage for d2gy9d1 (2gy9 D:2-205)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956861Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2956862Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2956863Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 2956864Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 2956868Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
    Uniprot P0A7V8 1-205
  8. 2956894Domain d2gy9d1: 2gy9 D:2-205 [145233]
    Other proteins in same PDB: d2gy9b1, d2gy9h1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9s1, d2gy9t1

Details for d2gy9d1

PDB Entry: 2gy9 (more details), 15 Å

PDB Description: Structure of the 30S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (D:) 30S ribosomal subunit protein S4

SCOPe Domain Sequences for d2gy9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gy9d1 d.66.1.2 (D:2-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
rylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkvr
riygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshka
imvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegtf
krkpersdlsadinehlivelysk

SCOPe Domain Coordinates for d2gy9d1:

Click to download the PDB-style file with coordinates for d2gy9d1.
(The format of our PDB-style files is described here.)

Timeline for d2gy9d1: