Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
Species Escherichia coli [TaxId:562] [160439] (26 PDB entries) Uniprot P0A7V8 1-205 |
Domain d2gy9d1: 2gy9 D:2-205 [145233] Other proteins in same PDB: d2gy9b1, d2gy9h1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9s1, d2gy9t1 |
PDB Entry: 2gy9 (more details), 15 Å
SCOPe Domain Sequences for d2gy9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gy9d1 d.66.1.2 (D:2-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} rylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkvr riygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshka imvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegtf krkpersdlsadinehlivelysk
Timeline for d2gy9d1: