Lineage for d2gy9b1 (2gy9 B:8-225)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858664Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 2858665Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 2858666Protein Ribosomal protein S2 [52315] (3 species)
  7. 2858676Species Escherichia coli [TaxId:562] [159491] (26 PDB entries)
    Uniprot P0A7V0 8-225
  8. 2858702Domain d2gy9b1: 2gy9 B:8-225 [145232]
    Other proteins in same PDB: d2gy9d1, d2gy9h1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9s1, d2gy9t1

Details for d2gy9b1

PDB Entry: 2gy9 (more details), 15 Å

PDB Description: Structure of the 30S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (B:) 30S ribosomal subunit protein S2

SCOPe Domain Sequences for d2gy9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gy9b1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
tnsdpdgvdfvipgnddairavtlylgavaatvregrs

SCOPe Domain Coordinates for d2gy9b1:

Click to download the PDB-style file with coordinates for d2gy9b1.
(The format of our PDB-style files is described here.)

Timeline for d2gy9b1: