PDB entry 2gy9
View 2gy9 on RCSB PDB site
Description: Structure of the 30S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
Class: ribosome
Keywords: SecM; nascent chain; signal transduction; RNA world; polypeptide exit tunnel; translocation; ribosome; elongation arrest
Deposited on
2006-05-09, released
2006-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated
2014-12-10, with a file datestamp of
2014-12-05.
Experiment type: EM
Resolution: 15 Å
R-factor: N/A
AEROSPACI score: -0.13
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 16S ribosomal RNA
Species: Escherichia coli [TaxId:562]
- Chain 'B':
Compound: 30S ribosomal subunit protein S2
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2gy9b1 - Chain 'C':
Compound: 30S ribosomal subunit protein S3
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: 30S ribosomal subunit protein S4
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2gy9d1 - Chain 'E':
Compound: 30S ribosomal subunit protein S5
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: 30S ribosomal subunit protein S6
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: 30S ribosomal subunit protein S7
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: 30S ribosomal subunit protein S8
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2gy9h1 - Chain 'I':
Compound: 30S ribosomal subunit protein S9
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2gy9i1 - Chain 'J':
Compound: 30S ribosomal subunit protein S10
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: 30S ribosomal subunit protein S11
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: 30S ribosomal subunit protein S12
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: 30S ribosomal subunit protein S13
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2gy9m1 - Chain 'N':
Compound: 30S ribosomal subunit protein S14
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Chain 'O':
Compound: 30S ribosomal subunit protein S15
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Chain 'P':
Compound: 30S ribosomal subunit protein S16
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2gy9p1 - Chain 'Q':
Compound: 30S ribosomal subunit protein S17
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2gy9q1 - Chain 'R':
Compound: 30S ribosomal subunit protein S18
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Chain 'S':
Compound: 30S ribosomal subunit protein S19
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2gy9s1 - Chain 'T':
Compound: 30S ribosomal subunit protein S20
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2gy9t1 - Chain 'U':
Compound: tRNA
Species: Escherichia coli [TaxId:562]
- Chain 'V':
Compound: tRNA
Species: Escherichia coli [TaxId:562]
- Chain 'W':
Compound: tRNA
Species: Escherichia coli [TaxId:562]
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2gy9B (B:)
mrdmlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkg
kilfvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgt
fdkltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfa
ivdtnsdpdgvdfvipgnddairavtlylgavaatvregrsqdlasqaeesfveae
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2gy9D (D:)
rylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkvr
riygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshka
imvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegtf
krkpersdlsadinehlivelysk
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>2gy9H (H:)
mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
geiicyv
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>2gy9I (I:)
qyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldly
itvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarrr
pqfskr
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'M':
Sequence; same for both SEQRES and ATOM records: (download)
>2gy9M (M:)
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpi
- Chain 'N':
No sequence available.
- Chain 'O':
No sequence available.
- Chain 'P':
Sequence; same for both SEQRES and ATOM records: (download)
>2gy9P (P:)
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikev
- Chain 'Q':
Sequence; same for both SEQRES and ATOM records: (download)
>2gy9Q (Q:)
rtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveirecr
plsktkswtlvrvvekavl
- Chain 'R':
No sequence available.
- Chain 'S':
Sequence; same for both SEQRES and ATOM records: (download)
>2gy9S (S:)
prslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvf
vtdemvghklgefaptrtyrghaadkk
- Chain 'T':
Sequence; same for both SEQRES and ATOM records: (download)
>2gy9T (T:)
ksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqaak
glihknkaarhkanltaqinkla
- Chain 'U':
No sequence available.
- Chain 'V':
No sequence available.
- Chain 'W':
No sequence available.