Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
Protein Ribosomal protein S9 [54218] (2 species) |
Species Escherichia coli [TaxId:562] [159907] (26 PDB entries) Uniprot P0A7X3 3-129 |
Domain d2gy9i1: 2gy9 I:4-129 [145234] Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9h1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9s1, d2gy9t1 |
PDB Entry: 2gy9 (more details), 15 Å
SCOPe Domain Sequences for d2gy9i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gy9i1 d.14.1.1 (I:4-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]} qyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldly itvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarrr pqfskr
Timeline for d2gy9i1: