Lineage for d2gy9q1 (2gy9 Q:5-82)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790014Protein Ribosomal protein S17 [50304] (3 species)
  7. 2790017Species Escherichia coli [TaxId:562] [159088] (26 PDB entries)
    Uniprot P02373 3-82
  8. 2790043Domain d2gy9q1: 2gy9 Q:5-82 [145237]
    Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9h1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9s1, d2gy9t1

Details for d2gy9q1

PDB Entry: 2gy9 (more details), 15 Å

PDB Description: Structure of the 30S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (Q:) 30S ribosomal subunit protein S17

SCOPe Domain Sequences for d2gy9q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gy9q1 b.40.4.5 (Q:5-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]}
rtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveirecr
plsktkswtlvrvvekav

SCOPe Domain Coordinates for d2gy9q1:

Click to download the PDB-style file with coordinates for d2gy9q1.
(The format of our PDB-style files is described here.)

Timeline for d2gy9q1: