Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.14: Lag-3 N-terminal region [158851] (1 family) long kinked helix, part of the CSL-Notch-Mastermind ternary complex |
Family a.137.14.1: Lag-3 N-terminal region [158852] (1 protein) |
Protein Abnormal cell lineage protein 3, Lag-3 [158853] (1 species) |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [158854] (1 PDB entry) Uniprot Q09260 52-114 |
Domain d2fo1d1: 2fo1 D:52-114 [145175] Other proteins in same PDB: d2fo1a1, d2fo1a2, d2fo1a3, d2fo1e1 protein/DNA complex |
PDB Entry: 2fo1 (more details), 3.12 Å
SCOPe Domain Sequences for d2fo1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fo1d1 a.137.14.1 (D:52-114) Abnormal cell lineage protein 3, Lag-3 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} edeptigdlnafhsgeelhrqrselaranyekarpemianqravtahlfnrytedeerkr veq
Timeline for d2fo1d1:
View in 3D Domains from other chains: (mouse over for more information) d2fo1a1, d2fo1a2, d2fo1a3, d2fo1e1 |