SCOPe 2.07: Domain d2fo1a3: 2fo1 A:381-541

Lineage for d2fo1a3 (2fo1 A:381-541)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.7: DNA-binding protein LAG-1 (CSL) [110217] (2 families)
   contains rudiment hairpin triplet lacking one hairpin
   automatically mapped to Pfam PF09270

5. Family b.42.7.1: DNA-binding protein LAG-1 (CSL) [110218] (1 protein)

6. Protein DNA-binding protein LAG-1 (CSL) [110219] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110220] (4 PDB entries)
   Uniprot Q9TYY1 195-660

8. Domain d2fo1a3: 2fo1 A:381-541 [133867]
   Other proteins in same PDB: d2fo1a1, d2fo1a2, d2fo1d1, d2fo1e1
   automatically matched to d1ttua3
   protein/DNA complex

Details for d2fo1a3

PDB Entry: 2fo1, 3.12 Å

PDB Description: Crystal Structure of the CSL-Notch-Mastermind ternary complex bound to DNA

PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform b

SCOPe Domain Sequences for d2fo1a3:

Sequence, based on SEQRES records:

>d2fo1a3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfdderglqetd
nfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqm
idnelvylclshdkiiqhqatainehrhqindgaawtiist

Sequence, based on observed residues (ATOM records):

>d2fo1a3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfddednfavrd
gfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqmidnelv
ylclshdkiiqhqatainehrhqindgaawtiist

Timeline for d2fo1a3:

• d2fo1a3 first appeared in SCOP 1.73
  
• d2fo1a3 appears in SCOPe 2.06
  
• d2fo1a3 appears in the current release, SCOPe 2.08