PDB entry 2fo1

View 2fo1 on RCSB PDB site
Description: Crystal Structure of the CSL-Notch-Mastermind ternary complex bound to DNA
Class: gene regulation/signalling protein/DNA
Keywords: beta-barrel, PROTEIN-DNA COMPLEX, DOUBLE HELIX, ankyrin repeat, GENE REGULATION/SIGNALLING PROTEIN/DNA COMPLEX
Deposited on 2006-01-12, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: 0.273
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin-12 and glp-1 phenotype protein 1, isoform b
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: LAG-1
    Database cross-references and differences (RAF-indexed):
    • GB AAM98006 (Start-476)
    Domains in SCOPe 2.07: d2fo1a1, d2fo1a2, d2fo1a3
  • Chain 'B':
    Compound: 5'-d(*tp*tp*ap*cp*tp*gp*tp*gp*gp*gp*ap*ap*ap*gp*a)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*ap*ap*tp*cp*tp*tp*tp*cp*cp*cp*ap*cp*ap*gp*t)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: Protein lag-3
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sel-8, lag-3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fo1d1
  • Chain 'E':
    Compound: Lin-12 protein
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: lin-12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14585
      • modified residue (10)
      • modified residue (17)
      • modified residue (20)
      • modified residue (161)
      • modified residue (170)
      • modified residue (185)
      • modified residue (213-214)
      • modified residue (217)
      • modified residue (235)
      • modified residue (239)
      • modified residue (291)
      • modified residue (317)
      • modified residue (329)
    Domains in SCOPe 2.07: d2fo1e1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fo1A (A:)
    gplgsgdsvqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciylig
    qgwklkkdrvaqlyktlkasaqkdaaiendpiheqqatelvayigigsdtserqqldfst
    gkvrhpgdqrqdpniydycaaktlyisdsdkrkyfdlnaqffygcgmeiggfvsqrikvi
    skpskkkqsmkntdckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaft
    ihlfdderglqetdnfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascs
    eepvsqlhkcafqmidnelvylclshdkiiqhqatainehrhqindgaawtiistdkaey
    rffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvettfrse
    eslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyksler
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fo1A (A:)
    vqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyligqgwklkkd
    rvaqlyktlkasaiheqqatelvayigigsdtserqqldfstgkvrhpniydycaaktly
    isdsdkrkyfdlnaqffygcgmeiggfvsqrikviskpskkdckylciasgtkvalfnrl
    rsqtvstrylhvegnafhasstkwgaftihlfddednfavrdgfvyygsvvklvdsvtgi
    alprlrirkvdkqqvildascseepvsqlhkcafqmidnelvylclshdkiiqhqatain
    ehrhqindgaawtiistdkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgr
    dfkpnlkvwfgatpvettfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvr
    ddgvvyssgltfsyksler
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fo1D (D:)
    spnpedeptigdlnafhsgeelhrqrselaranyekarpemianqravtahlfnrytede
    erkrveqqknkeamnastsaptssr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fo1D (D:)
    edeptigdlnafhsgeelhrqrselaranyekarpemianqravtahlfnrytedeerkr
    veq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fo1E (E:)
    gsgnrtrkrrminasvwmppmeneeknrknhqsitssqhslleasydgyikrqrnelqhy
    slypnpqgygngndflgdfnhtnlqiptepepespiklhteaagsyaitepitresvnii
    dprhnrtvlhwiasnssaeksedlivheakeciaagadvnamdcdentplmlavlarrrr
    lvaylmkagadptiynksersalhqaaanrdfgmmvymlnstklkgdieeldrngmtalm
    ivahnegrdqvasakllvekgakvdydgaarkdsekykgrtalhyaaqvsnmpivkylvg
    ekgsnkdkqdedgktpimlaaqegrievvmyliqqgasveavdatdhtarqlaqannhhn
    ivdifdrcrpere
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fo1E (E:)
    rtrkrrminasvwmppmeneespiklhteaagsyaitepitresvniidprhnrtvlhwi
    asnssaeksedlivheakeciaagadvnamdcdentplmlavlarrrrlvaylmkagadp
    tiynksersalhqaaanrdfgmmvymlnstklkgdieeldrngmtalmivahnegrdqva
    sakllvekgakvdydgaarkdsekykgrtalhyaaqvsnmpivkylvgekgsnkdkqded
    gktpimlaaqegrievvmyliqqgasveavdatdhtarqlaqannhhnivdifdrcr