Lineage for d2fo1e1 (2fo1 E:1021-1297)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612404Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2612452Protein Lin-12 [160152] (1 species)
  7. 2612453Species Nematode (Caenorhabditis elegans) [TaxId:6239] [160153] (1 PDB entry)
    Uniprot P14585 1021-1297
  8. 2612454Domain d2fo1e1: 2fo1 E:1021-1297 [145176]
    Other proteins in same PDB: d2fo1a1, d2fo1a2, d2fo1a3, d2fo1d1
    protein/DNA complex

Details for d2fo1e1

PDB Entry: 2fo1 (more details), 3.12 Å

PDB Description: Crystal Structure of the CSL-Notch-Mastermind ternary complex bound to DNA
PDB Compounds: (E:) Lin-12 protein

SCOPe Domain Sequences for d2fo1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
espiklhteaagsyaitepitresvniidprhnrtvlhwiasnssaeksedlivheakec
iaagadvnamdcdentplmlavlarrrrlvaylmkagadptiynksersalhqaaanrdf
gmmvymlnstklkgdieeldrngmtalmivahnegrdqvasakllvekgakvdydgaark
dsekykgrtalhyaaqvsnmpivkylvgekgsnkdkqdedgktpimlaaqegrievvmyl
iqqgasveavdatdhtarqlaqannhhnivdifdrcr

SCOPe Domain Coordinates for d2fo1e1:

Click to download the PDB-style file with coordinates for d2fo1e1.
(The format of our PDB-style files is described here.)

Timeline for d2fo1e1: