| Class g: Small proteins [56992] (94 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) ![]() |
| Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 |
| Protein automated matches [190609] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187631] (5 PDB entries) |
| Domain d2dsqa_: 2dsq A: [145089] Other proteins in same PDB: d2dsqc_, d2dsqg1, d2dsqh_, d2dsqi_ automated match to d2dspb1 |
PDB Entry: 2dsq (more details), 2.8 Å
SCOPe Domain Sequences for d2dsqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dsqa_ g.3.9.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcyp
prgvekplhtlmhgqgvcmelaeieaiqesl
Timeline for d2dsqa_: