Lineage for d2dsqc_ (2dsq C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2256769Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2256770Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2256771Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2256992Protein Insulin-like growth factor [57002] (1 species)
  7. 2256993Species Human (Homo sapiens) [TaxId:9606] [57003] (22 PDB entries)
    Uniprot P05019 49-110
  8. 2257003Domain d2dsqc_: 2dsq C: [131696]
    Other proteins in same PDB: d2dsqa_, d2dsqb_, d2dsqg1, d2dsqh_
    automated match to d1bqt__

Details for d2dsqc_

PDB Entry: 2dsq (more details), 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (C:) Insulin-like growth factor IB

SCOPe Domain Sequences for d2dsqc_:

Sequence, based on SEQRES records: (download)

>d2dsqc_ g.1.1.1 (C:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
ap

Sequence, based on observed residues (ATOM records): (download)

>d2dsqc_ g.1.1.1 (C:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkpttgivdeccfrscdlrrlemycap

SCOPe Domain Coordinates for d2dsqc_:

Click to download the PDB-style file with coordinates for d2dsqc_.
(The format of our PDB-style files is described here.)

Timeline for d2dsqc_: