SCOP 1.75: Domain d2dsqa1: 2dsq A:2-92

Lineage for d2dsqa1 (2dsq A:2-92)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (1 family)

5. Family g.3.9.1: Growth factor receptor domain [57185] (8 proteins)

6. Protein Insulin-like growth factor-binding protein 4, IGFBP4 [161124] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161125] (2 PDB entries)
   Uniprot P22692 22-113

8. Domain d2dsqa1: 2dsq A:2-92 [145089]
   Other proteins in same PDB: d2dsqc1, d2dsqg1, d2dsqh1, d2dsqi1
   automatically matched to 2DSP B:1-92

Details for d2dsqa1

PDB Entry: 2dsq, 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins

PDB Compounds: (A:) Insulin-like growth factor-binding protein 4

SCOP Domain Sequences for d2dsqa1:

Sequence; same for both SEQRES and ATOM records:

>d2dsqa1 g.3.9.1 (A:2-92) Insulin-like growth factor-binding protein 4, IGFBP4 {Human (Homo sapiens) [TaxId: 9606]}
eaihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcyp
prgvekplhtlmhgqgvcmelaeieaiqesl

Timeline for d2dsqa1:

• d2dsqa1 is new in SCOP 1.75
  
• d2dsqa1 is called d2dsqa_ in SCOPe 2.01
  
• d2dsqa1 appears in the current release, SCOPe 2.08, called d2dsqa_