Lineage for d2dsqg1 (2dsq G:149-231)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261607Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 2261608Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (2 families) (S)
  5. 2261609Family g.28.1.1: Thyroglobulin type-1 domain [57611] (5 proteins)
    Pfam PF00086
  6. 2261618Protein Insulin-like growth factor-binding protein 1, IGFBP1 [161142] (1 species)
  7. 2261619Species Human (Homo sapiens) [TaxId:9606] [161143] (1 PDB entry)
    Uniprot P08833 174-256
  8. 2261620Domain d2dsqg1: 2dsq G:149-231 [145091]
    Other proteins in same PDB: d2dsqa_, d2dsqb_, d2dsqc_, d2dsqh_, d2dsqi_

Details for d2dsqg1

PDB Entry: 2dsq (more details), 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (G:) Insulin-like growth factor-binding protein 1

SCOPe Domain Sequences for d2dsqg1:

Sequence, based on SEQRES records: (download)

>d2dsqg1 g.28.1.1 (G:149-231) Insulin-like growth factor-binding protein 1, IGFBP1 {Human (Homo sapiens) [TaxId: 9606]}
epcrielyrvveslakaqetsgeeiskfylpncnkngfyhsrqcetsmdgeaglcwcvyp
wngkripgspeirgdpncqiyfn

Sequence, based on observed residues (ATOM records): (download)

>d2dsqg1 g.28.1.1 (G:149-231) Insulin-like growth factor-binding protein 1, IGFBP1 {Human (Homo sapiens) [TaxId: 9606]}
epcrielyrvveslakaskfylpncnkngfyhsrqcetsmeaglcwcvypwngkripgsp
eirgdpncqiyfn

SCOPe Domain Coordinates for d2dsqg1:

Click to download the PDB-style file with coordinates for d2dsqg1.
(The format of our PDB-style files is described here.)

Timeline for d2dsqg1: