SCOPe 2.08: Domain d2clyd_: 2cly D:

Lineage for d2clyd_ (2cly D:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.52: ATP synthase B chain-like [161059] (1 superfamily)
   long single helix, part of the stator subcomplex

4. Superfamily f.52.1: ATP synthase B chain-like [161060] (1 family)

5. Family f.52.1.1: ATP synthase B chain-like [161061] (1 protein)
   Pfam PF05405

6. Protein ATP synthase subunit b, mitochondrial [161062] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [161063] (1 PDB entry)
   Uniprot P13619 121-225

8. Domain d2clyd_: 2cly D: [145044]
   Other proteins in same PDB: d2clyb1, d2clyc_, d2clye_, d2clyf_
   automated match to d2clya1

Details for d2clyd_

PDB Entry: 2cly, 2.8 Å

PDB Description: subcomplex of the stator of bovine mitochondrial atp synthase

PDB Compounds: (D:) ATP synthase b chain, mitochondrial

SCOPe Domain Sequences for d2clyd_:

Sequence; same for both SEQRES and ATOM records:

>d2clyd_ f.52.1.1 (D:) ATP synthase subunit b, mitochondrial {Cow (Bos taurus) [TaxId: 9913]}
gefadklneqkiaqleevkqasikqiqdaidmeksqqalvqkrhylfdvqrnniamalev
tyrerlhrvyrevknrldyhisvqnmmrqkeqehminwvekrvvq

Timeline for d2clyd_:

• d2clyd_ first appeared in SCOP 1.75, called d2clyd1
  
• d2clyd_ appears in SCOPe 2.07