SCOPe 2.08: Domain d2clyb1: 2cly B:4-123

Lineage for d2clyb1 (2cly B:4-123)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.53: ATP synthase D chain-like [161064] (1 superfamily)
   non-globular, mostly helical component of the stator subcomplex

4. Superfamily f.53.1: ATP synthase D chain-like [161065] (1 family)
   automatically mapped to Pfam PF05873

5. Family f.53.1.1: ATP synthase D chain-like [161066] (1 protein)
   Pfam PF05873

6. Protein ATP synthase subunit d, mitochondrial [161067] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [161068] (1 PDB entry)
   Uniprot P13620 4-123

8. Domain d2clyb1: 2cly B:4-123 [145043]
   Other proteins in same PDB: d2clya1, d2clyc_, d2clyd_, d2clyf_

Details for d2clyb1

PDB Entry: 2cly, 2.8 Å

PDB Description: subcomplex of the stator of bovine mitochondrial atp synthase

PDB Compounds: (B:) ATP synthase d chain, mitochondrial

SCOPe Domain Sequences for d2clyb1:

Sequence; same for both SEQRES and ATOM records:

>d2clyb1 f.53.1.1 (B:4-123) ATP synthase subunit d, mitochondrial {Cow (Bos taurus) [TaxId: 9913]}
klalktidwvafgeiiprnqkavanslkswnetltsrlatlpekppaidwayykanvaka
glvddfekkfnalkvpipedkytaqvdaeekedvkscaefltqsktriqeyekelekmrn

Timeline for d2clyb1:

• d2clyb1 first appeared in SCOP 1.75
  
• d2clyb1 appears in SCOPe 2.07