![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.52: ATP synthase B chain-like [161059] (1 superfamily) long single helix, part of the stator subcomplex |
![]() | Superfamily f.52.1: ATP synthase B chain-like [161060] (1 family) ![]() |
![]() | Family f.52.1.1: ATP synthase B chain-like [161061] (1 protein) Pfam PF05405 |
![]() | Protein ATP synthase subunit b, mitochondrial [161062] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [161063] (1 PDB entry) Uniprot P13619 121-225 |
![]() | Domain d2clya1: 2cly A:79-183 [145042] Other proteins in same PDB: d2clyb1, d2clyc_, d2clye_, d2clyf_ |
PDB Entry: 2cly (more details), 2.8 Å
SCOPe Domain Sequences for d2clya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clya1 f.52.1.1 (A:79-183) ATP synthase subunit b, mitochondrial {Cow (Bos taurus) [TaxId: 9913]} gefadklneqkiaqleevkqasikqiqdaidmeksqqalvqkrhylfdvqrnniamalev tyrerlhrvyrevknrldyhisvqnmmrqkeqehminwvekrvvq
Timeline for d2clya1: