SCOPe 2.08: Domain d2clyf_: 2cly F:

Lineage for d2clyf_ (2cly F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.45: Mitochondrial ATP synthase coupling factor 6 [111356] (1 superfamily)
   2 helices, hairpin

4. Superfamily f.45.1: Mitochondrial ATP synthase coupling factor 6 [111357] (1 family)
   automatically mapped to Pfam PF05511

5. Family f.45.1.1: Mitochondrial ATP synthase coupling factor 6 [111358] (1 protein)
   Pfam PF05511

6. Protein ATPase subunit F6 [111359] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [111360] (2 PDB entries)
   Uniprot P02721 33-108

8. Domain d2clyf_: 2cly F: [130602]
   Other proteins in same PDB: d2clya1, d2clyb1, d2clyd_, d2clye_
   automated match to d1vzsa_

Details for d2clyf_

PDB Entry: 2cly, 2.8 Å

PDB Description: subcomplex of the stator of bovine mitochondrial atp synthase

PDB Compounds: (F:) ATP synthase coupling factor 6, mitochondrial

SCOPe Domain Sequences for d2clyf_:

Sequence; same for both SEQRES and ATOM records:

>d2clyf_ f.45.1.1 (F:) ATPase subunit F6 {Cow (Bos taurus) [TaxId: 9913]}
ldpvqklfvdkireyrtkrqtsggpvdagpeyqqdldrelfklkqmygkadmntfpnftf
edpkfe

Timeline for d2clyf_:

• d2clyf_ first appeared in SCOP 1.73, called d2clyf1
  
• d2clyf_ appears in SCOPe 2.07