![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.45: Mitochondrial ATP synthase coupling factor 6 [111356] (1 superfamily) 2 helices, hairpin |
![]() | Superfamily f.45.1: Mitochondrial ATP synthase coupling factor 6 [111357] (1 family) ![]() automatically mapped to Pfam PF05511 |
![]() | Family f.45.1.1: Mitochondrial ATP synthase coupling factor 6 [111358] (1 protein) Pfam PF05511 |
![]() | Protein ATPase subunit F6 [111359] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [111360] (2 PDB entries) Uniprot P02721 33-108 |
![]() | Domain d2clyf_: 2cly F: [130602] Other proteins in same PDB: d2clya1, d2clyb1, d2clyd_, d2clye_ automated match to d1vzsa_ |
PDB Entry: 2cly (more details), 2.8 Å
SCOPe Domain Sequences for d2clyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clyf_ f.45.1.1 (F:) ATPase subunit F6 {Cow (Bos taurus) [TaxId: 9913]} ldpvqklfvdkireyrtkrqtsggpvdagpeyqqdldrelfklkqmygkadmntfpnftf edpkfe
Timeline for d2clyf_: