SCOPe 2.08: Domain d2aw4i1: 2aw4 I:73-141

Lineage for d2aw4i1 (2aw4 I:73-141)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
   Uniprot P0A7J7 73-141

8. Domain d2aw4i1: 2aw4 I:73-141 [144874]
   Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4g1, d2aw4g2, d2aw4h1, d2aw4h2, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1
   Representative structure
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2aw4i1

PDB Entry: 2aw4, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2aw4i1:

Sequence; same for both SEQRES and ATOM records:

>d2aw4i1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

Timeline for d2aw4i1:

• d2aw4i1 first appeared in SCOP 1.75
  
• d2aw4i1 appears in SCOPe 2.07