Lineage for d2aw4c1 (2aw4 C:125-269)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2784107Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 2784108Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 2784118Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
    Uniprot P60422 125-269
  8. 2784134Domain d2aw4c1: 2aw4 C:125-269 [144865]
    Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4g1, d2aw4g2, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1
    Representative structure
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2aw4c1

PDB Entry: 2aw4 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2aw4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw4c1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

SCOPe Domain Coordinates for d2aw4c1:

Click to download the PDB-style file with coordinates for d2aw4c1.
(The format of our PDB-style files is described here.)

Timeline for d2aw4c1: