Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
Species Escherichia coli [TaxId:562] [159642] (29 PDB entries) Uniprot P0C018 1-117 |
Domain d2aw4o1: 2aw4 O:1-117 [144879] Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4g1, d2aw4g2, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1 Representative structure protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2aw4 (more details), 3.46 Å
SCOPe Domain Sequences for d2aw4o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw4o1 c.55.4.1 (O:1-117) Ribosomal protein L18 (L18p) {Escherichia coli [TaxId: 562]} mdkksarirratrarrklqelgatrlvvhrtprhiyaqviapngsevlvaastvekaiae qlkytgnkdaaaavgkavaeralekgikdvsfdrsgfqyhgrvqaladaareaglqf
Timeline for d2aw4o1:
View in 3D Domains from other chains: (mouse over for more information) d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4g1, d2aw4g2, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1 |