Lineage for d2a9hd_ (2a9h D:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577062Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2577083Protein Potassium channel protein [56901] (3 species)
  7. 2577123Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries)
  8. 2577156Domain d2a9hd_: 2a9h D: [144792]
    Other proteins in same PDB: d2a9he1
    automated match to d1r3jc_

Details for d2a9hd_

PDB Entry: 2a9h (more details)

PDB Description: NMR structural studies of a potassium channel / charybdotoxin complex
PDB Compounds: (D:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2a9hd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9hd_ f.14.1.1 (D:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly
pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq

SCOPe Domain Coordinates for d2a9hd_:

Click to download the PDB-style file with coordinates for d2a9hd_.
(The format of our PDB-style files is described here.)

Timeline for d2a9hd_: