SCOPe 2.08: Domain d2a9hd_: 2a9h D:

Lineage for d2a9hd_ (2a9h D:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (3 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries)

8. Domain d2a9hd_: 2a9h D: [144792]
   Other proteins in same PDB: d2a9he1
   automated match to d1r3jc_

Details for d2a9hd_

PDB Entry: 2a9h

PDB Description: nmr structural studies of a potassium channel / charybdotoxin complex

PDB Compounds: (D:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2a9hd_:

Sequence; same for both SEQRES and ATOM records:

>d2a9hd_ f.14.1.1 (D:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly
pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq

Timeline for d2a9hd_:

• d2a9hd_ first appeared in SCOP 1.75, called d2a9hd1
  
• d2a9hd_ appears in SCOPe 2.07