Lineage for d2a9he1 (2a9h E:801-837)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030614Protein Charybdotoxin [57131] (1 species)
  7. 3030615Species Scorpion (Leiurus quinquestriatus hebraeus) [TaxId:6884] [57132] (5 PDB entries)
  8. 3030618Domain d2a9he1: 2a9h E:801-837 [126439]
    Other proteins in same PDB: d2a9ha1, d2a9hb_, d2a9hc_, d2a9hd_
    automatically matched to d1bah__

Details for d2a9he1

PDB Entry: 2a9h (more details)

PDB Description: nmr structural studies of a potassium channel / charybdotoxin complex
PDB Compounds: (E:) charybdotoxin

SCOPe Domain Sequences for d2a9he1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9he1 g.3.7.2 (E:801-837) Charybdotoxin {Scorpion (Leiurus quinquestriatus hebraeus) [TaxId: 6884]}
eftnvscttskecwsvcqrlhntsrgkcmnkkcrcys

SCOPe Domain Coordinates for d2a9he1:

Click to download the PDB-style file with coordinates for d2a9he1.
(The format of our PDB-style files is described here.)

Timeline for d2a9he1: