![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
![]() | Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
![]() | Protein Charybdotoxin [57131] (1 species) |
![]() | Species Scorpion (Leiurus quinquestriatus hebraeus) [TaxId:6884] [57132] (5 PDB entries) |
![]() | Domain d2a9he1: 2a9h E:801-837 [126439] Other proteins in same PDB: d2a9ha1, d2a9hb_, d2a9hc_, d2a9hd_ automatically matched to d1bah__ |
PDB Entry: 2a9h (more details)
SCOPe Domain Sequences for d2a9he1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9he1 g.3.7.2 (E:801-837) Charybdotoxin {Scorpion (Leiurus quinquestriatus hebraeus) [TaxId: 6884]} eftnvscttskecwsvcqrlhntsrgkcmnkkcrcys
Timeline for d2a9he1:
![]() Domains from other chains: (mouse over for more information) d2a9ha1, d2a9hb_, d2a9hc_, d2a9hd_ |