Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (3 species) |
Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries) |
Domain d2a9hd_: 2a9h D: [144792] Other proteins in same PDB: d2a9he1 automated match to d1r3jc_ |
PDB Entry: 2a9h (more details)
SCOPe Domain Sequences for d2a9hd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9hd_ f.14.1.1 (D:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq
Timeline for d2a9hd_:
View in 3D Domains from other chains: (mouse over for more information) d2a9ha1, d2a9hb_, d2a9hc_, d2a9he1 |