Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (3 species) |
Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
Domain d2a9ha1: 2a9h A:23-119 [144789] Other proteins in same PDB: d2a9he1 |
PDB Entry: 2a9h (more details)
SCOPe Domain Sequences for d2a9ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9ha1 f.14.1.1 (A:23-119) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq
Timeline for d2a9ha1:
View in 3D Domains from other chains: (mouse over for more information) d2a9hb_, d2a9hc_, d2a9hd_, d2a9he1 |