Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) |
Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (2 proteins) |
Protein Pyruvate dehydrogenase kinase [69807] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [160702] (5 PDB entries) Uniprot Q15120 177-301 |
Domain d1y8na2: 1y8n A:177-301 [144602] Other proteins in same PDB: d1y8na1, d1y8nb1 complexed with k, red |
PDB Entry: 1y8n (more details), 2.6 Å
SCOPe Domain Sequences for d1y8na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8na2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} npvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnakapdkpiqvvy vpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisdlgggvplrk idrlf
Timeline for d1y8na2: